PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do020395.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family MYB
Protein Properties Length: 296aa    MW: 32721.7 Da    PI: 9.3931
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do020395.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.95.3e-092973346
                     SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + l  +  +W+ +ar ++ gR+  ++++++ +
       Do020395.1 29 SWTAEENKQFERALAGLDLRcpDWEQVARAIP-GRSVREVVHHFKS 73
                     6*****************99************.**********986 PP

2Myb_DNA-binding48.12.6e-15144188347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
       Do020395.1 144 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 188
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.5842579IPR017884SANT domain
SMARTSM007177.5E-52677IPR001005SANT/Myb domain
SuperFamilySSF466893.52E-82982IPR009057Homeodomain-like
CDDcd001672.40E-72974No hitNo description
PfamPF002491.2E-62974IPR001005SANT/Myb domain
PROSITE profilePS5129418.359137193IPR017930Myb domain
SuperFamilySSF466896.35E-18138193IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-17140191IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.3E-12141187IPR009057Homeodomain-like
SMARTSM007173.4E-13141191IPR001005SANT/Myb domain
CDDcd001677.86E-12144189No hitNo description
PfamPF002491.0E-12144188IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MMRETYMEVL PPMDHLAARN SWYPAAVRSW TAEENKQFER ALAGLDLRCP DWEQVARAIP  60
GRSVREVVHH FKSLEVDVQQ IESGLVPFPF YGGGGGAAGS FTLQWDGNGG GGPGDFRHAY  120
RFGGGCGKRH PGRTPEQERK KGVPWTEEEH KLFLLGLKKY GKGDWRNISR NFVQTRTPTQ  180
VASHAQKYFI RLNSGGKDKR RSSIHDITMV NLTDDRPPSP SQSSLVNNQS NASAPTTGVG  240
QFSLTEDAKQ HGTANLPFNS PSRTLGMPTF GMGLQDQGLQ CGPLHDQLVG NQSMLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-152896978RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968168.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H77e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XKK30.0K3XKK3_SETIT; Uncharacterized protein
STRINGSi002426m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.17e-62MYB family protein